PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla022378
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family CO-like
Protein Properties Length: 337aa    MW: 36969.2 Da    PI: 6.3107
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla022378genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box22.91.8e-07436436
   zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg 36
               + C+ +++  ++lfC+ ++ +lC  C ++ H  
  Cla022378  4 KLCDSCKSATATLFCRADSAFLCLGCDSKVHAA 36
               68**************************99954 PP

2zf-B_box24.94.3e-084691342
   zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42
                ++C+ +e+ +++  C+ +   lC +C   +H+       H++vp+
  Cla022378 46 VWVCEVCEQAPAHVTCKADAAALCLTCDHDIHSAnplarrHERVPV 91
               689*****************************66899999*99986 PP

3CCT70.44.4e-24276319144
        CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                Rea++lRY+eKrk+RkFeK+irY+sRKa+Ae+RpR+KGrF+k++
  Cla022378 276 REARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRT 319
                9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003362.0E-13148IPR000315B-box-type zinc finger
PROSITE profilePS5011910.523148IPR000315B-box-type zinc finger
PfamPF006431.5E-5443IPR000315B-box-type zinc finger
CDDcd000216.53E-9548No hitNo description
PROSITE profilePS5011910.684491IPR000315B-box-type zinc finger
PfamPF006432.2E-64691IPR000315B-box-type zinc finger
CDDcd000212.79E-84791No hitNo description
SMARTSM003365.9E-94991IPR000315B-box-type zinc finger
PROSITE profilePS5101716.787276318IPR010402CCT domain
PfamPF062035.0E-18276318IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 337 aa     Download sequence    Send to blast
MASKLCDSCK SATATLFCRA DSAFLCLGCD SKVHAANKLA SRHARVWVCE VCEQAPAHVT  60
CKADAAALCL TCDHDIHSAN PLARRHERVP VTPFYDTSNS DNSLAVKPSA AINFLDDRYF  120
SDVDGDAADV SREEAEAASW LLPNPNPKAI ESSDLNSGKF EFPEMDPYLD LDYGHVDPKL  180
EAQEQNSSGA DGVVPVQSKG VNLSSVNDRC FGIDFPSTKS FPYGYNPQSI SHSVSSSSIE  240
VGVVPDGNAM TDVSNPYTKP STESTVQPLQ ISPADREARV LRYREKRKNR KFEKTIRYAS  300
RKAYAETRPR IKGRFAKRTD IELDVDRVSG YGVVPSF
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818230.0LN681823.1 Cucumis melo genomic scaffold, anchoredscaffold00014.
GenBankLN7132570.0LN713257.1 Cucumis melo genomic chromosome, chr_3.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008445288.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 4
SwissprotQ940T91e-144COL4_ARATH; Zinc finger protein CONSTANS-LIKE 4
TrEMBLA0A0A0LSP80.0A0A0A0LSP8_CUCSA; Uncharacterized protein
STRINGVIT_04s0008g07340.t011e-153(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13023493
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G24930.11e-143CONSTANS-like 4